Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNG6 Rabbit Polyclonal Antibody (Biotin)

CACNG6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9BXT2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CACNG6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKAN

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_665814

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAH11 siRNA Oligos set (Human)
48072171 3x 5 nmol

TRNAH11 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Recombinant Lamin B2 Rabbit mAb
E38MA4444 100 µL

Recombinant Lamin B2 Rabbit mAb

Sign In for Pricing
View Details
CEBPB Rabbit mAb
orb1923581-01 20 ul

CEBPB Rabbit mAb

Sign In for Pricing
View Details
CEBPB Rabbit mAb
orb1923581-02 50 µL

CEBPB Rabbit mAb

Sign In for Pricing
View Details
CEBPB Rabbit mAb
orb1923581-03 100 µL

CEBPB Rabbit mAb

Sign In for Pricing
View Details
IGF1, CT (IGF1, IBP1, Insulin-like growth factor I, Mechano growth factor, Somatomedin-C) (FITC) discontinued
036904-FITC 200 µL

IGF1, CT (IGF1, IBP1, Insulin-like growth factor I, Mechano growth factor, Somatomedin-C) (FITC) discontinued

Sign In for Pricing
View Details