Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RX2 Rabbit Polyclonal Antibody (FITC)

P2RX2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P2X2, DFNA41

UniProt

Q9UBL9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human P2RX2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKGI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057402

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Vitelline membrane outer layer protein 1 homolog (VMO1) ELISA Kit
AE11631MO-01 48 Tests

Mouse Vitelline membrane outer layer protein 1 homolog (VMO1) ELISA Kit

Sign In for Pricing
View Details
Mouse Vitelline membrane outer layer protein 1 homolog (VMO1) ELISA Kit
AE11631MO-02 96 Tests

Mouse Vitelline membrane outer layer protein 1 homolog (VMO1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human HELLS Protein, N-His
MBS1577520-01 0.1 mg

Recombinant Human HELLS Protein, N-His

Sign In for Pricing
View Details
Recombinant Human HELLS Protein, N-His
MBS1577520-02 1 mg

Recombinant Human HELLS Protein, N-His

Sign In for Pricing
View Details
Recombinant Human HELLS Protein, N-His
MBS1577520-03 5x 1 mg

Recombinant Human HELLS Protein, N-His

Sign In for Pricing
View Details
Multiplex Assay Kit for N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0026317 96 Tests

Multiplex Assay Kit for N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details