Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNAB2 Rabbit Polyclonal Antibody (Biotin)

KCNAB2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AKR6A5, KCNA2B, HKvbeta2, KV-BETA-2, HKvbeta2.1, HKvbeta2.2

UniProt

Q13303

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KCNAB2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_742128

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-Off-mmu-miR-669d-5p Vector
mm30896 500 ng

LentimiRa-Off-mmu-miR-669d-5p Vector

Sign In for Pricing
View Details
ATP10D antibody - C-terminal region (ARP49516_P050)
ARP49516_P050 100 µL

ATP10D antibody - C-terminal region (ARP49516_P050)

Sign In for Pricing
View Details
ARHGAP40 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2747408 1.0 µg DNA

ARHGAP40 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
KCNMA1/BK channel Rabbit Polyclonal Antibody (Biotin)
orb457377 100 µL

KCNMA1/BK channel Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
QKI Rabbit Polyclonal Antibody
orb589785 100 µL

QKI Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DNAJC8 (NM_014280) Human Mass Spec Standard
PH307697 10 µg

DNAJC8 (NM_014280) Human Mass Spec Standard

Sign In for Pricing
View Details