Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNH5 Rabbit Polyclonal Antibody (HRP)

KCNH5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EAG2, hEAG2, H-EAG2, Kv10.2

UniProt

Q8NCM2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCNH5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_758963

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELP4 Mouse Monoclonal Antibody [Clone ID: OTI3A4]
CF809150 100 µg

ELP4 Mouse Monoclonal Antibody [Clone ID: OTI3A4]

Sign In for Pricing
View Details
Recombinant Human Tumor-associated Calcium Signal Transducer 2/TROP-2 (C-Avi-6His) Biotinylated
PKSH034007-01 20 µg

Recombinant Human Tumor-associated Calcium Signal Transducer 2/TROP-2 (C-Avi-6His) Biotinylated

Sign In for Pricing
View Details
Recombinant Human Tumor-associated Calcium Signal Transducer 2/TROP-2 (C-Avi-6His) Biotinylated
PKSH034007-02 100 µg

Recombinant Human Tumor-associated Calcium Signal Transducer 2/TROP-2 (C-Avi-6His) Biotinylated

Sign In for Pricing
View Details
MGMT Mouse Monoclonal Antibody [Clone ID: OTI2F10]
CF809131 100 µg

MGMT Mouse Monoclonal Antibody [Clone ID: OTI2F10]

Sign In for Pricing
View Details
KIAA0040 (NM_001162894) Human Over-expression Lysate
LY431069 100 µg

KIAA0040 (NM_001162894) Human Over-expression Lysate

Sign In for Pricing
View Details
Fluo-4 AM *Ultrapure Grade* *CAS 273221-67-3*
20550-AAT 1 mg

Fluo-4 AM *Ultrapure Grade* *CAS 273221-67-3*

Sign In for Pricing
View Details