Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD20 Rabbit Polyclonal Antibody (HRP)

KCTD20 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C6orf69, dJ108K11.3

UniProt

Q7Z5Y7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KCTD20

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DSVDWDEDHPPPMGEEYSQILYSSKLYRFFKYIENRDVAKTVLKERGLKN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_005248997

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/1623), CF640R conjugate, 0.1mg/mL
BNC403804-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/1623), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CREB1 pSer133 Rabbit Polyclonal Antibody
AP01566PU-N 100 µg

CREB1 pSer133 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD36 Polyclonal Antibody
E-AB-16315-01 20 µL

CD36 Polyclonal Antibody

Sign In for Pricing
View Details
CD36 Polyclonal Antibody
E-AB-16315-02 60 µL

CD36 Polyclonal Antibody

Sign In for Pricing
View Details
CD36 Polyclonal Antibody
E-AB-16315-03 120 µL

CD36 Polyclonal Antibody

Sign In for Pricing
View Details
CD36 Polyclonal Antibody
E-AB-16315-04 200 µL

CD36 Polyclonal Antibody

Sign In for Pricing
View Details