Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RX2 Rabbit Polyclonal Antibody (FITC)

P2RX2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P2X2, DFNA41

UniProt

Q9UBL9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human P2RX2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IRIDVIVHGQAGKFSLIPTIINLATALTSVGVVRNPLWGPSGCGGSTRPL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_733783

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human DnaJ (Hsp40) homolog, subfamily B, member 14 polyclonal Antibody
MBS714757-01 0.1 mL

Rabbit anti-human DnaJ (Hsp40) homolog, subfamily B, member 14 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human DnaJ (Hsp40) homolog, subfamily B, member 14 polyclonal Antibody
MBS714757-02 5x 0.1 mL

Rabbit anti-human DnaJ (Hsp40) homolog, subfamily B, member 14 polyclonal Antibody

Sign In for Pricing
View Details
ULK2 (unc-51-like Kinase 2 (C. elegans), KIAA0623, Unc51.2)
253273 100 µg

ULK2 (unc-51-like Kinase 2 (C. elegans), KIAA0623, Unc51.2)

Sign In for Pricing
View Details
MEOX1 (Mesenchyme Homeobox 1, MOX1) (MaxLight 405)
MBS6196693-01 0.1 mL

MEOX1 (Mesenchyme Homeobox 1, MOX1) (MaxLight 405)

Sign In for Pricing
View Details
MEOX1 (Mesenchyme Homeobox 1, MOX1) (MaxLight 405)
MBS6196693-02 5x 0.1 mL

MEOX1 (Mesenchyme Homeobox 1, MOX1) (MaxLight 405)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum DNA-directed RNA polymerases I and III subunit rpac1 (polr1c)
MBS1399145-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum DNA-directed RNA polymerases I and III subunit rpac1 (polr1c)

Sign In for Pricing
View Details