Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF132 Rabbit Polyclonal Antibody (HRP)

ZNF132 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PHZ-12

UniProt

P52740

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF132

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GQKPYSNLGQLPEVCTTQKLFECSNCGKAFLKSSTLPNHLRTHSEEIPFT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_003424

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plant Phospholemman (PLM) ELISA Kit
MBS9373344 Inquire

Plant Phospholemman (PLM) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal G gamma7 Antibody
NBP2-46845-25ul 25 µL

Rabbit Polyclonal G gamma7 Antibody

Sign In for Pricing
View Details
AIM2 Human qPCR Primer Pair (NM_004833)
HP208094 200 Reactions

AIM2 Human qPCR Primer Pair (NM_004833)

Sign In for Pricing
View Details
SLC26A3 (Chloride Anion Exchanger, Down-regulated in Adenoma, Protein DRA, Solute Carrier Family 26 Member 3, DRA) (PE)
MBS6160324-01 0.1 mL

SLC26A3 (Chloride Anion Exchanger, Down-regulated in Adenoma, Protein DRA, Solute Carrier Family 26 Member 3, DRA) (PE)

Sign In for Pricing
View Details
SLC26A3 (Chloride Anion Exchanger, Down-regulated in Adenoma, Protein DRA, Solute Carrier Family 26 Member 3, DRA) (PE)
MBS6160324-02 5x 0.1 mL

SLC26A3 (Chloride Anion Exchanger, Down-regulated in Adenoma, Protein DRA, Solute Carrier Family 26 Member 3, DRA) (PE)

Sign In for Pricing
View Details
Recombinant Mouse Granulocyte-macrophage colony-stimulating factor protein (Csf2) (Active)
orb1650772-01 5 µg

Recombinant Mouse Granulocyte-macrophage colony-stimulating factor protein (Csf2) (Active)

Sign In for Pricing
View Details