Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF135 Rabbit Polyclonal Antibody (FITC)

ZNF135 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PT3, ZNF61, pHZ-17, ZNF78L1

UniProt

P52742

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF135

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ELWAVESRLPQGVYPDLETRPKVKLSVLKQGISEEISNSVILVERFLWDG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_003427

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYO7B ELISA Kit (Human) (OKCA02124)
OKCA02124 96 Well

MYO7B ELISA Kit (Human) (OKCA02124)

Sign In for Pricing
View Details
HIST2H2AA4 ORF Vector (Human) (pORF)
ORF004931 1.0 µg DNA

HIST2H2AA4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Dog C-C Motif Chemokine 4 / MIP1B (CCL4) ELISA Kit
abx511743 96 Well

Dog C-C Motif Chemokine 4 / MIP1B (CCL4) ELISA Kit

Sign In for Pricing
View Details
KLRG2, NT (KLRG2, CLEC15B, Killer cell lectin-like receptor subfamily G member 2, C-type lectin domain family 15 member B) (MaxLight 405)
MBS6314397-01 0.1 mL

KLRG2, NT (KLRG2, CLEC15B, Killer cell lectin-like receptor subfamily G member 2, C-type lectin domain family 15 member B) (MaxLight 405)

Sign In for Pricing
View Details
KLRG2, NT (KLRG2, CLEC15B, Killer cell lectin-like receptor subfamily G member 2, C-type lectin domain family 15 member B) (MaxLight 405)
MBS6314397-02 5x 0.1 mL

KLRG2, NT (KLRG2, CLEC15B, Killer cell lectin-like receptor subfamily G member 2, C-type lectin domain family 15 member B) (MaxLight 405)

Sign In for Pricing
View Details
KRT38 Polyclonal Antibody, Biotin Conjugated
A57144-100 100 µL

KRT38 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details