Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF732 Rabbit Polyclonal Antibody (Biotin)

ZNF732 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

B4DXR9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human ZNF732

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NPDLVTCLEQRKEPYNVKIHKIVARPPAMCSHFTQDHWPVQGIEDSFHKL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_001131080.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish snai1b Antibody Fluoro488 Conjugated
DZ41229-Fluoro488 200 µL/Vial

Anti-Zebrafish snai1b Antibody Fluoro488 Conjugated

Sign In for Pricing
View Details
ATG4D, ID (ATG4D, APG4D, AUTL4, Cysteine protease ATG4D, AUT-like 4 cysteine endopeptidase, Autophagin-4, Autophagy-related cysteine endopeptidase 4, Autophagy-related protein 4 homolog D) (MaxLight 750) discontinued
032222-ML750 100 µL

ATG4D, ID (ATG4D, APG4D, AUTL4, Cysteine protease ATG4D, AUT-like 4 cysteine endopeptidase, Autophagin-4, Autophagy-related cysteine endopeptidase 4, Autophagy-related protein 4 homolog D) (MaxLight 750) discontinued

Sign In for Pricing
View Details
USF2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2594606 1.0 µg DNA

USF2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
COMMD6 Conjugated Antibody
MBS9451274-01 0.1 mL (Biotin)

COMMD6 Conjugated Antibody

Sign In for Pricing
View Details
COMMD6 Conjugated Antibody
MBS9451274-02 0.1 mL (AF350)

COMMD6 Conjugated Antibody

Sign In for Pricing
View Details
COMMD6 Conjugated Antibody
MBS9451274-03 0.1 mL (AF405)

COMMD6 Conjugated Antibody

Sign In for Pricing
View Details