Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB44 Rabbit Polyclonal Antibody (Biotin)

ZBTB44 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BTBD15, ZNF851, HSPC063

UniProt

Q8NCP5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZBTB44

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SRRKRKSYIVMSPESPVKCGTQTSSPQVLNSSASYSENRNQPVDSSLAFP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_054874

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARTS1, ID (Endoplasmic Reticulum Aminopeptidase 1, Adipocyte-derived Leucine Aminopeptidase, A-LAP, ARTS-1, Aminopeptidase PILS, Puromycin-insensitive Leucyl-specific Aminopeptidase, PILS-AP, Type 1 Tumor Necrosis Factor Receptor Shedding Aminopeptidase Regulator, ERAP1, APPILS, KIAA0525, UNQ584/PRO1154)
E2291-50A 200 µL

ARTS1, ID (Endoplasmic Reticulum Aminopeptidase 1, Adipocyte-derived Leucine Aminopeptidase, A-LAP, ARTS-1, Aminopeptidase PILS, Puromycin-insensitive Leucyl-specific Aminopeptidase, PILS-AP, Type 1 Tumor Necrosis Factor Receptor Shedding Aminopeptidase Regulator, ERAP1, APPILS, KIAA0525, UNQ584/PRO1154)

Sign In for Pricing
View Details
Cst12 (NM_027054) Mouse Tagged ORF Clone Lentiviral Particle
MR217498L3V 200 µL

Cst12 (NM_027054) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Striatin shRNA (m) Lentiviral Particles
sc-37650-V 200 µL

Striatin shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Goat Anti-Human IgG gamma chain Antibody (Cy5.5)
orb705851-01 100 µL

Goat Anti-Human IgG gamma chain Antibody (Cy5.5)

Sign In for Pricing
View Details
Goat Anti-Human IgG gamma chain Antibody (Cy5.5)
orb705851-02 500 μL

Goat Anti-Human IgG gamma chain Antibody (Cy5.5)

Sign In for Pricing
View Details
Goat Anti-Human IgG gamma chain Antibody (Cy5.5)
orb705851-03 1 mL

Goat Anti-Human IgG gamma chain Antibody (Cy5.5)

Sign In for Pricing
View Details