Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L3MBTL Rabbit Polyclonal Antibody (HRP)

L3MBTL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L3MBTL, ZC2HC3, H-L (3) MBT, dJ138B7.3

UniProt

Q9Y468

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human L3MBTL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLKPMKKRKRREYQSPSEEESEPEAMEKQEEGKDPEGQPTASTPESEEWS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

86kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056293

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFP Mouse Monoclonal Antibody (Plant Specific)
E12-156 100 µg -100 µL

GFP Mouse Monoclonal Antibody (Plant Specific)

Sign In for Pricing
View Details
C19orf51 Antibody (Center)
E45R03556G-4 50 µL

C19orf51 Antibody (Center)

Sign In for Pricing
View Details
Supt4h2 shRNA (m) Lentiviral Particles
sc-38439-V 200 µL

Supt4h2 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
XRN1 ORF Vector (Human) (pORF)
50571011 1.0 µg DNA

XRN1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Pitpna Rat siRNA Oligo Duplex (Locus ID 29525)
SR514519 1 Kit

Pitpna Rat siRNA Oligo Duplex (Locus ID 29525)

Sign In for Pricing
View Details
ZIC4, CT (Zinc Finger Protein ZIC 4, Zinc Finger Protein Of The Cerebellum 4) (MaxLight 405) discontinued
Z0424-ML405 100 µL

ZIC4, CT (Zinc Finger Protein ZIC 4, Zinc Finger Protein Of The Cerebellum 4) (MaxLight 405) discontinued

Sign In for Pricing
View Details