Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF307 Rabbit Polyclonal Antibody (HRP)

ZNF307 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF307, ZNF427, ZSCAN36, P1P373C6

UniProt

Q969J2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF307

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAREPRKNAALDAQSAEDQTGLLTVKVEKEEASALTAEVRAPCSPARGPE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_061983

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H2A.Z (H2AFZ) Rabbit Polyclonal Antibody
TA377044 100 µL

H2A.Z (H2AFZ) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SRP9 (NM_003133) Human Over-expression Lysate
LY418876 100 µg

SRP9 (NM_003133) Human Over-expression Lysate

Sign In for Pricing
View Details
SESN2 Rabbit Polyclonal Antibody
TA367250 100 µL

SESN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
n-Myc (MYCN) Mouse Monoclonal Antibody [Clone ID: OTI2E5]
CF809374 100 µg

n-Myc (MYCN) Mouse Monoclonal Antibody [Clone ID: OTI2E5]

Sign In for Pricing
View Details
ABHD10 Rabbit Polyclonal Antibody
TA370548 100 µL

ABHD10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calgranulin B / MRP-8/-14 / MAC 387 / S100A8/A9 / Macrophage Ag (MAC387), CF640R conjugate, 0.1mg/mL
BNC400035-100 1x 100 µL

Calgranulin B / MRP-8/-14 / MAC 387 / S100A8/A9 / Macrophage Ag (MAC387), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details