Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR0B2 Rabbit Polyclonal Antibody (HRP)

NR0B2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SHP, SHP1

UniProt

Q15466

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NR0B2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VQWLQCCLESFWSLELSPKEYACLKGTILFNPDVPGLQAASHIGHLQQEA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068804

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fnta sgRNA CRISPR Lentivector (Rat) (Target 2)
K6918703 1.0 µg DNA

Fnta sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Dectin-1 (C-type Lectin Domain Family 7 Member A, Dendritic Cell-associated C-type Lectin 1, DC-associated C-type Lectin 1, Beta-glucan Receptor, beta-GR, C-type Lectin Superfamily Member 12, CLEC7A, BGR, CLECSF12, DECTIN1, UNQ539/PRO1082) discontinued
D1876-48P 250 µg

Dectin-1 (C-type Lectin Domain Family 7 Member A, Dendritic Cell-associated C-type Lectin 1, DC-associated C-type Lectin 1, Beta-glucan Receptor, beta-GR, C-type Lectin Superfamily Member 12, CLEC7A, BGR, CLECSF12, DECTIN1, UNQ539/PRO1082) discontinued

Sign In for Pricing
View Details
FAR2 3'UTR Lenti-reporter-Luc Vector
20244081 1.0 µg

FAR2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Lentiviral mouse R3hdm4 shRNA (UAS) - Lentiviral mouse R3hdm4 shRNA (UAS, RFP) (100)
GTR15265608 1 Vial

Lentiviral mouse R3hdm4 shRNA (UAS) - Lentiviral mouse R3hdm4 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
17a-Hydroxyprogesterone (17-Hydroxy-pregn-4-ene-3,20-dione, 4-Pregnen-17a-ol-3,20-dione) discontinued
H9111-32A 1 mg

17a-Hydroxyprogesterone (17-Hydroxy-pregn-4-ene-3,20-dione, 4-Pregnen-17a-ol-3,20-dione) discontinued

Sign In for Pricing
View Details
PYCRL (Pyrroline-5-Carboxylate Reductase 3, P5C Reductase 3, P5CR 3, Pyrroline-5-Carboxylate Reductase-like Protein, PYCRL) (HRP) discontinued
302684-HRP 200 µL

PYCRL (Pyrroline-5-Carboxylate Reductase 3, P5C Reductase 3, P5CR 3, Pyrroline-5-Carboxylate Reductase-like Protein, PYCRL) (HRP) discontinued

Sign In for Pricing
View Details