Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBF2 Rabbit Polyclonal Antibody (Biotin)

EBF2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

COE2, OE-3, EBF-2, O/E-3

UniProt

Q9HAK2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EBF2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GDPERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRN

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_073150

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lysyl aspartyl isoleucine
orb1696224 25 mg

Lysyl aspartyl isoleucine

Sign In for Pricing
View Details
GNG2 Rabbit Polyclonal Antibody (PE)
orb2603993 100 µg

GNG2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Anti-Zebrafish LFT1 Antibody Picoband® APC Conjugated
AZQ9PW55-APC 100 µg/Vial

Anti-Zebrafish LFT1 Antibody Picoband® APC Conjugated

Sign In for Pricing
View Details
BRD4 (Bromodomain-containing Protein 4, Protein HUNK1, HUNK1) (MaxLight 490)
MBS6371426-01 0.1 mL

BRD4 (Bromodomain-containing Protein 4, Protein HUNK1, HUNK1) (MaxLight 490)

Sign In for Pricing
View Details
BRD4 (Bromodomain-containing Protein 4, Protein HUNK1, HUNK1) (MaxLight 490)
MBS6371426-02 5x 0.1 mL

BRD4 (Bromodomain-containing Protein 4, Protein HUNK1, HUNK1) (MaxLight 490)

Sign In for Pricing
View Details
Nori® Duck HMGA2 ELISA Kit
GR149090 96 Well

Nori® Duck HMGA2 ELISA Kit

Sign In for Pricing
View Details