Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF665 Rabbit Polyclonal Antibody (Biotin)

ZNF665 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZFP160L

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF665

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CGKAFTVRSNLTIHQVIHTGEKPYKCNECGKVFSQPSNLAGHQRIHTGEK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peroxiredoxin 5 (PRDX5) Mouse Monoclonal Antibody [Clone ID: OTI3A1]
CF811480 100 µg

Peroxiredoxin 5 (PRDX5) Mouse Monoclonal Antibody [Clone ID: OTI3A1]

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1997R), CF647 conjugate, 0.1mg/mL
BNC471997-100 1x 100 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1997R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human VPS37A activation kit by CRISPRa
GA115282 1 Kit

Human VPS37A activation kit by CRISPRa

Sign In for Pricing
View Details
CD4 (C4/206), CF488A conjugate, 0.1mg/mL
BNC880206-100 1x 100 µL

CD4 (C4/206), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(5-Chloro-2-nitrophenyl)(phenyl)carbamic Acid tert-Butyl Ester
TRC-C368545-250MG 250 mg

(5-Chloro-2-nitrophenyl)(phenyl)carbamic Acid tert-Butyl Ester

Sign In for Pricing
View Details
Cplx1 Mouse Gene Knockout Kit (CRISPR)
KN503755 1 Kit

Cplx1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details