Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF559 Rabbit Polyclonal Antibody (FITC)

ZNF559 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NBLA00121

UniProt

Q9BR84

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF559

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QCEKAFRKPSIFTLHKKTDIGEELPNCNQCETAFSQHLHLVCKKTSQNLH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_115886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SF3B2 (Splicing Factor 3B Subunit 2, Pre-mRNA-Splicing Factor SF3b 145kD Subunit, SF3b145, SF3b150, Spliceosome-Associated Protein 145, SAP 145, SF3B2, SAP145)
335412-01 50 µL

SF3B2 (Splicing Factor 3B Subunit 2, Pre-mRNA-Splicing Factor SF3b 145kD Subunit, SF3b145, SF3b150, Spliceosome-Associated Protein 145, SAP 145, SF3B2, SAP145)

Sign In for Pricing
View Details
SF3B2 (Splicing Factor 3B Subunit 2, Pre-mRNA-Splicing Factor SF3b 145kD Subunit, SF3b145, SF3b150, Spliceosome-Associated Protein 145, SAP 145, SF3B2, SAP145)
335412-02 100 µL

SF3B2 (Splicing Factor 3B Subunit 2, Pre-mRNA-Splicing Factor SF3b 145kD Subunit, SF3b145, SF3b150, Spliceosome-Associated Protein 145, SAP 145, SF3B2, SAP145)

Sign In for Pricing
View Details
Recombinant Bordetella parapertussis UPF0246 protein BPP3440 (BPP3440)
MBS1283618-01 0.02 mg (E-Coli)

Recombinant Bordetella parapertussis UPF0246 protein BPP3440 (BPP3440)

Sign In for Pricing
View Details
Recombinant Bordetella parapertussis UPF0246 protein BPP3440 (BPP3440)
MBS1283618-02 0.1 mg (E-Coli)

Recombinant Bordetella parapertussis UPF0246 protein BPP3440 (BPP3440)

Sign In for Pricing
View Details
Recombinant Bordetella parapertussis UPF0246 protein BPP3440 (BPP3440)
MBS1283618-03 0.02 mg (Yeast)

Recombinant Bordetella parapertussis UPF0246 protein BPP3440 (BPP3440)

Sign In for Pricing
View Details
Recombinant Bordetella parapertussis UPF0246 protein BPP3440 (BPP3440)
MBS1283618-04 0.1 mg (Yeast)

Recombinant Bordetella parapertussis UPF0246 protein BPP3440 (BPP3440)

Sign In for Pricing
View Details