Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF778 Rabbit Polyclonal Antibody (Biotin)

ZNF778 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ31875, MGC150573

UniProt

Q96MU6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF778

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ARSHNGGQLCDRTQCGEAFSEHSGLSTHVRTQNTGDSCVSNHYERDFFIP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_872337

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Streptococcus Pneumoniae tet Protein (aa 1-458)
VAng-Ly1502-1mgEcoli 1 mg (E. coli)

Recombinant Streptococcus Pneumoniae tet Protein (aa 1-458)

Sign In for Pricing
View Details
Human Solute Carrier Family 30, Member 6 (SLC30A6) ELISA Kit
BSKH64281-01 48 Tests

Human Solute Carrier Family 30, Member 6 (SLC30A6) ELISA Kit

Sign In for Pricing
View Details
Human Solute Carrier Family 30, Member 6 (SLC30A6) ELISA Kit
BSKH64281-02 96 Tests

Human Solute Carrier Family 30, Member 6 (SLC30A6) ELISA Kit

Sign In for Pricing
View Details
GRID1 Rabbit Polyclonal Antibody (Cy3)
orb984119 100 µL

GRID1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Mxd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3972006 1.0 µg DNA

Mxd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
MBD3 Rabbit Polyclonal Antibody
TA315506 100 µL

MBD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details