Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF835 Rabbit Polyclonal Antibody (HRP)

ZNF835 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BC37295_3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BC37295_3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YTCQDCGALFSQSASLAEHRRIHTGEKPYACGQCAKAFTQVSHLTQHQRT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_032059

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCP4 (Macrophage/Monocyte Chemotactic Protein 4) (AP) discontinued
M2750-18A-AP 100 µL

MCP4 (Macrophage/Monocyte Chemotactic Protein 4) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Pig Nociceptin (PNOC)
MBS953498-01 0.05 mg (E-Coli)

Recombinant Pig Nociceptin (PNOC)

Sign In for Pricing
View Details
Recombinant Pig Nociceptin (PNOC)
MBS953498-02 0.2 mg (E-Coli)

Recombinant Pig Nociceptin (PNOC)

Sign In for Pricing
View Details
Recombinant Pig Nociceptin (PNOC)
MBS953498-03 0.5 mg (E-Coli)

Recombinant Pig Nociceptin (PNOC)

Sign In for Pricing
View Details
Recombinant Pig Nociceptin (PNOC)
MBS953498-04 0.05 mg (Yeast)

Recombinant Pig Nociceptin (PNOC)

Sign In for Pricing
View Details
Recombinant Pig Nociceptin (PNOC)
MBS953498-05 0.05 mg (Baculovirus)

Recombinant Pig Nociceptin (PNOC)

Sign In for Pricing
View Details