Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKAP7 Rabbit Polyclonal Antibody (FITC)

AKAP7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AKAP15, AKAP18

UniProt

Q9P0M2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AKAP7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LELKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGDHVNSLLEIAET

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057461

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

High Binding 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS
MGW01F-HB8 50x 96 Well Plates

High Binding 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS

Sign In for Pricing
View Details
Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3294), CF647 conjugate, 0.1mg/mL
BNC473294-500 1x 500 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3294), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Stereo Zoom Microscope BMIC-901
BMIC-901 1 Unit

Stereo Zoom Microscope BMIC-901

Sign In for Pricing
View Details
GFAP (GA-5), CF568 conjugate, 0.1mg/mL
BNC680167-500 1x 500 µL

GFAP (GA-5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), Biotin conjugate, 0.1mg/mL
BNCB1786-100 1x 100 µL

P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GABRB1 Polyclonal Antibody
E-AB-11258-01 20 µL

GABRB1 Polyclonal Antibody

Sign In for Pricing
View Details