Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHX38 Rabbit Polyclonal Antibody (HRP)

DHX38 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RP84, DDX38, PRP16, PRPF16

UniProt

Q92620

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HKHWELAGTKLGDIMGVKKEEEPDKAVTEDGKVDYRTEQKFADHMKRKSE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

140kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054722

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9-Chlorophenazine-1-carboxylic Acid
TRC-C374973-5MG 5 mg

9-Chlorophenazine-1-carboxylic Acid

Sign In for Pricing
View Details
MIR3162 Human qPCR Primer Pair (MI0014192)
HP300773 200 Reactions

MIR3162 Human qPCR Primer Pair (MI0014192)

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (57), CF488A conjugate, 0.1mg/mL
BNC880139-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (57), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C4BPA (NM_000715) Human Over-expression Lysate
LC424544 20 µg

C4BPA (NM_000715) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS627588 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
ROM1 Polyclonal Antibody
E-AB-18687-01 20 µL

ROM1 Polyclonal Antibody

Sign In for Pricing
View Details