Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX47 Rabbit Polyclonal Antibody (FITC)

DDX47 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RRP3, E4-DBP, HQ0256, MSTP162

UniProt

Q9H0S4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DDX47

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETP

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057439

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Metrine antibody
bs-71165R 100 µL

Metrine antibody

Sign In for Pricing
View Details
Suppressors of Cytokine Signaling 3 (SOCS3) Antibody
abx238100 100 µg

Suppressors of Cytokine Signaling 3 (SOCS3) Antibody

Sign In for Pricing
View Details
Mouse Fam110b Pre-designed siRNA Set A
SI104580A 1 Each

Mouse Fam110b Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Rat SCGN Protein, His, E.coli-2ug
QP13431-2ug 2ug

Recombinant Rat SCGN Protein, His, E.coli-2ug

Sign In for Pricing
View Details
Monkey Hyaluronan Synthase 1 ELISA Kit
MBS072888-01 48 Well

Monkey Hyaluronan Synthase 1 ELISA Kit

Sign In for Pricing
View Details
Monkey Hyaluronan Synthase 1 ELISA Kit
MBS072888-02 96 Well

Monkey Hyaluronan Synthase 1 ELISA Kit

Sign In for Pricing
View Details