Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX55 Rabbit Polyclonal Antibody (Biotin)

DDX55 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8NHQ9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DDX55

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065987

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MG53/TRIM72 Rabbit Polyclonal Antibody (PE)
orb2592422 100 µg

MG53/TRIM72 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Human FGF-21 Recombinant Protein Lyophilized
MBS8432024-01 0.005 mg

Human FGF-21 Recombinant Protein Lyophilized

Sign In for Pricing
View Details
Human FGF-21 Recombinant Protein Lyophilized
MBS8432024-02 5x 0.005 mg

Human FGF-21 Recombinant Protein Lyophilized

Sign In for Pricing
View Details
Human Signal Peptide, CUB and EGF-like Domain-containing Protein 1 (SCUBE1) ELISA Kit
abx251765-01 96 Tests

Human Signal Peptide, CUB and EGF-like Domain-containing Protein 1 (SCUBE1) ELISA Kit

Sign In for Pricing
View Details
Human Signal Peptide, CUB and EGF-like Domain-containing Protein 1 (SCUBE1) ELISA Kit
abx251765-02 5x 96 Tests

Human Signal Peptide, CUB and EGF-like Domain-containing Protein 1 (SCUBE1) ELISA Kit

Sign In for Pricing
View Details
Human Signal Peptide, CUB and EGF-like Domain-containing Protein 1 (SCUBE1) ELISA Kit
abx251765-03 10x 96 Tests

Human Signal Peptide, CUB and EGF-like Domain-containing Protein 1 (SCUBE1) ELISA Kit

Sign In for Pricing
View Details