Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mycbp Rabbit Polyclonal Antibody (HRP)

Mycbp Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Amy-, Amy-1, AW552132, AW742590, 5730488M09Rik

UniProt

Q9EQS3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Mycbp

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HLGAATPENPEIELLRLELAEMKEKYEATVEENKKLKAKLVQYEPPQEEK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_062634

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Borrelia burgdorferi Chaperone protein DnaK (dnaK), partial
MBS1158048 Inquire

Recombinant Borrelia burgdorferi Chaperone protein DnaK (dnaK), partial

Sign In for Pricing
View Details
GMPR2 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-13463R-PerCP-Cy5.5 100 µL

GMPR2 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Human Sorting Nexin 17 (SNX17) ELISA Kit
RD-SNX17-Hu-48Tests 48 Tests

Human Sorting Nexin 17 (SNX17) ELISA Kit

Sign In for Pricing
View Details
TMSB10 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
47156156 3x 1.0 µg DNA

TMSB10 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
SPATA1 Antibody
E308663 200 µL

SPATA1 Antibody

Sign In for Pricing
View Details
CryoMajor 10/50
2174000 1 Each

CryoMajor 10/50

Sign In for Pricing
View Details