Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mycbp Rabbit Polyclonal Antibody (HRP)

Mycbp Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Amy-, Amy-1, AW552132, AW742590, 5730488M09Rik

UniProt

Q9EQS3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Mycbp

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HLGAATPENPEIELLRLELAEMKEKYEATVEENKKLKAKLVQYEPPQEEK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_062634

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal CDK12 / CRKRS Antibody (C-Terminus)
APR02059G 0.05mg

Polyclonal CDK12 / CRKRS Antibody (C-Terminus)

Sign In for Pricing
View Details
Recombinant Human Far upstream element-binding protein 1/FUBP1 (C-His)
BP2596-500ug 500 µg

Recombinant Human Far upstream element-binding protein 1/FUBP1 (C-His)

Sign In for Pricing
View Details
Mcoln3 Mouse qPCR Primer Pair (NM_134160)
MP208432 200 Reactions

Mcoln3 Mouse qPCR Primer Pair (NM_134160)

Sign In for Pricing
View Details
Mouse Monoclonal MLKL [p Thr357] Antibody (954724) [Janelia Fluor 549]
MAB91871JF549 0.1 mL

Mouse Monoclonal MLKL [p Thr357] Antibody (954724) [Janelia Fluor 549]

Sign In for Pricing
View Details
C19orf18 Protein Vector (Human) (pPM-C-His)
PV065972 500 ng

C19orf18 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
cystatin 8 HDR Plasmid (h)
sc-417214-HDR 20 µg

cystatin 8 HDR Plasmid (h)

Sign In for Pricing
View Details