Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gja10 Rabbit Polyclonal Antibody (Biotin)

Gja10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Cx57, Cxnn, Cx-57, RGD1309630

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Gja10

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TENETGPPFHSTNYSGAQQCMVCSSLPERVSLLQANNKQQVIRVNIPRSK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001166979

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAH2 (N-term) Rabbit Polyclonal Antibody
AP51283PU-N 400 µL

DNAH2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZAP70 Polyclonal Antibody
E-AB-53218-01 20 µL

ZAP70 Polyclonal Antibody

Sign In for Pricing
View Details
ZAP70 Polyclonal Antibody
E-AB-53218-02 60 µL

ZAP70 Polyclonal Antibody

Sign In for Pricing
View Details
ZAP70 Polyclonal Antibody
E-AB-53218-03 120 µL

ZAP70 Polyclonal Antibody

Sign In for Pricing
View Details
ZAP70 Polyclonal Antibody
E-AB-53218-04 200 µL

ZAP70 Polyclonal Antibody

Sign In for Pricing
View Details
KCNT1 (C-term) Rabbit Polyclonal Antibody
AP32321PU-N 50 µL

KCNT1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details