Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM2 Rabbit Polyclonal Antibody (Biotin)

MCM2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BM28, CCNL1, CDCL1, cdc19, DFNA70, D3S3194, MITOTIN

UniProt

P49736

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MCM2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

102kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004517

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD105 (CD105 Antigen, Endoglin, END, ENG, FLJ41744, HHT1, Osler-Rendu-Weber Syndrome 1, ORW1, ORW, RP11-228B15.2) (AP)
MBS6247439-01 0.1 mL

CD105 (CD105 Antigen, Endoglin, END, ENG, FLJ41744, HHT1, Osler-Rendu-Weber Syndrome 1, ORW1, ORW, RP11-228B15.2) (AP)

Sign In for Pricing
View Details
CD105 (CD105 Antigen, Endoglin, END, ENG, FLJ41744, HHT1, Osler-Rendu-Weber Syndrome 1, ORW1, ORW, RP11-228B15.2) (AP)
MBS6247439-02 5x 0.1 mL

CD105 (CD105 Antigen, Endoglin, END, ENG, FLJ41744, HHT1, Osler-Rendu-Weber Syndrome 1, ORW1, ORW, RP11-228B15.2) (AP)

Sign In for Pricing
View Details
SPATS2 Rabbit Polyclonal Antibody (Biotin)
orb2082091 100 µL

SPATS2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
GALR3 Rabbit Polyclonal Antibody (APC-Cy7)
orb2543466 100 µL

GALR3 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Bcat2 Antibody
orb863016 2 mg

Bcat2 Antibody

Sign In for Pricing
View Details
RN5S191 Protein Vector (Human) (pPB-C-His)
PV116318 500 ng

RN5S191 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details