Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM6 Rabbit Polyclonal Antibody (HRP)

MCM6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mis5, P105MCM, MCG40308

UniProt

Q14566

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MCM6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_005906

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (HSPB1) Rabbit Polyclonal Antibody
AP02743PU-N 100 µL

HSP27 (HSPB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
n-Nonadecanoic Acid
TRC-N649200-1G 1 g

n-Nonadecanoic Acid

Sign In for Pricing
View Details
Recombinant Human UPRT Protein (His Tag)
PKSH033196-01 10 µg

Recombinant Human UPRT Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human UPRT Protein (His Tag)
PKSH033196-02 50 µg

Recombinant Human UPRT Protein (His Tag)

Sign In for Pricing
View Details
Medium Binding 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS
MGW0F-MB 50x 96 Well Plates

Medium Binding 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS

Sign In for Pricing
View Details
Texas Red Conjugated Goat Polyclonal Antibody to Human IgG
TA-2100-2 2 mL

Texas Red Conjugated Goat Polyclonal Antibody to Human IgG

Sign In for Pricing
View Details