Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM9 Rabbit Polyclonal Antibody (FITC)

MCM9 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ODG4, MCMDC1, C6orf61, dJ329L24.1, dJ329L24.3

UniProt

B3KV41

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MCM9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_694987

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RLBP1 3'UTR Lenti-reporter-Luc Vector
39619081 1.0 µg

RLBP1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse SHBG ELISA Kit (Ready to Use)
orb554075-01 48 Tests

Mouse SHBG ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Mouse SHBG ELISA Kit (Ready to Use)
orb554075-02 96 Tests

Mouse SHBG ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
RUBISCO Polyclonal Antibody, Cy5 Conjugated
bs-6988R-Cy5 100 µL

RUBISCO Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
AmpHifi HS DNA Polymerase -V3
BR3P103-56 1000 U

AmpHifi HS DNA Polymerase -V3

Sign In for Pricing
View Details
Human Pulmonary Surfactant Associated Protein A ELISA Kit
MBS760555-01 48 Well

Human Pulmonary Surfactant Associated Protein A ELISA Kit

Sign In for Pricing
View Details