Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUNX2 Rabbit Polyclonal Antibody (Biotin)

RUNX2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CCD, AML3, CCD1, CLCD, OSF2, CBFA1, OSF-2, PEA2aA, PEBP2aA, CBF-alpha-1

UniProt

Q13950

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RUNX2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDRLSDLGRIPHPSMR

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human DAPK3 sgRNA gene knockout kit - Lentiviral human DAPK3 sgRNA gene knockout kit (plasmid)
GTR15380630 1 Vial

Lentiviral human DAPK3 sgRNA gene knockout kit - Lentiviral human DAPK3 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Immuno HRP-DAB, Anti-Chicken IgY (H+L)
orb2652848 15 mL

Immuno HRP-DAB, Anti-Chicken IgY (H+L)

Sign In for Pricing
View Details
KISS1 (Metastasis-suppressor KiSS-1, Kisspeptin-1, Metastin, PP5098, MGC39258) (MaxLight 405)
MBS6190863-01 0.1 mL

KISS1 (Metastasis-suppressor KiSS-1, Kisspeptin-1, Metastin, PP5098, MGC39258) (MaxLight 405)

Sign In for Pricing
View Details
KISS1 (Metastasis-suppressor KiSS-1, Kisspeptin-1, Metastin, PP5098, MGC39258) (MaxLight 405)
MBS6190863-02 5x 0.1 mL

KISS1 (Metastasis-suppressor KiSS-1, Kisspeptin-1, Metastin, PP5098, MGC39258) (MaxLight 405)

Sign In for Pricing
View Details
IFIT5 Rabbit Polyclonal Antibody (Biotin)
orb2599959 100 µg

IFIT5 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Tegoprazan Impurity 3
RM-T051603-01 10 mg

Tegoprazan Impurity 3

Sign In for Pricing
View Details