Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD11 Rabbit Polyclonal Antibody (FITC)

KCTD11 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

REN, KCASH1, C17orf36, REN/KCTD11

UniProt

Q693B1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD11

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPH

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_001002914

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hax1 Rat Pre-designed siRNA Set A
HY-RS28718 1 Set

Hax1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
ADGRG2/GPR64 Antibody
orb1533340 50 µg

ADGRG2/GPR64 Antibody

Sign In for Pricing
View Details
ADAM13 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-13736R-PerCP-Cy5.5 100 µL

ADAM13 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Prl3d1 sgRNA CRISPR Lentivector set (Mouse)
K4372201 3x 1.0 µg

Prl3d1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
CXADR sgRNA CRISPR Lentivector (Human) (Target 2)
K0534303 1.0 µg DNA

CXADR sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Tea polyphenol
orb1221269-01 100 mg

Tea polyphenol

Sign In for Pricing
View Details