Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Etv2 Rabbit Polyclonal Antibody (HRP)

Etv2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Etsr, Etsrp71

UniProt

P41163

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDLWNWDEASLQEVPPGDKLTGLGAEFGFYFPEVALQEDTPITPMNVEGC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_031985

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCAN1 Antibody, HRP conjugated
A32971-100UG 100 µg

RCAN1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Lrrc68 sgRNA CRISPR Lentivector set (Rat)
K6658201 3x 1.0 µg

Lrrc68 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Tert-ButylhydroPeroxide 70% in water Extra Pure
00576 00100 100 mL

Tert-ButylhydroPeroxide 70% in water Extra Pure

Sign In for Pricing
View Details
TMED1 Human shRNA Lentiviral Particle (Locus ID 11018)
TL308779V 500 µL Each

TMED1 Human shRNA Lentiviral Particle (Locus ID 11018)

Sign In for Pricing
View Details
Rabbit Polyclonal Pellino 1 Antibody [CoraFluor 1]
NBP2-81888CL1 0.1 mL

Rabbit Polyclonal Pellino 1 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
USP16 (NM_001001992) Human Tagged Lenti ORF Clone
RC205268L4 10 µg

USP16 (NM_001001992) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details