Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxq1 Rabbit Polyclonal Antibody (Biotin)

Foxq1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Sa, Hfh1, HFH-1, Hfh1l

UniProt

Q9JJ18

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse Foxq1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MKLEVFVPRAAHGDKMGSDLEGAGSSDVPSPLSAAGDDSLGSDGDCAANS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_032265

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Receptor-type tyrosine-protein phosphatase kappa,PTPRK ELISA KIT
JOT-EK2476Hu-01 48 Well

Human Receptor-type tyrosine-protein phosphatase kappa,PTPRK ELISA KIT

Sign In for Pricing
View Details
Human Receptor-type tyrosine-protein phosphatase kappa,PTPRK ELISA KIT
JOT-EK2476Hu-02 96 Well

Human Receptor-type tyrosine-protein phosphatase kappa,PTPRK ELISA KIT

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor, Vascular Permeability Factor, VEGFA, VPF) (MaxLight 490)
MBS6505547-01 0.1 mL

VEGF (Vascular Endothelial Growth Factor, Vascular Permeability Factor, VEGFA, VPF) (MaxLight 490)

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor, Vascular Permeability Factor, VEGFA, VPF) (MaxLight 490)
MBS6505547-02 5x 0.1 mL

VEGF (Vascular Endothelial Growth Factor, Vascular Permeability Factor, VEGFA, VPF) (MaxLight 490)

Sign In for Pricing
View Details
MMP-2, hinge region (matrix metallopeptidase 2, 72kD Gelatinase, 72kD Type IV Collagenase, CLG4, CLG4A, Gelatinase A, Matrix Metalloproteinase-2, MMP-II, MONA, TBE-1) (HRP) discontinued
M2436-01A-HRP 100 µL

MMP-2, hinge region (matrix metallopeptidase 2, 72kD Gelatinase, 72kD Type IV Collagenase, CLG4, CLG4A, Gelatinase A, Matrix Metalloproteinase-2, MMP-II, MONA, TBE-1) (HRP) discontinued

Sign In for Pricing
View Details
Gas Permeable Heat Seal Mk2Roll
PCR0884 1 Roll

Gas Permeable Heat Seal Mk2Roll

Sign In for Pricing
View Details