Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXD1 Rabbit Polyclonal Antibody (HRP)

FOXD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BF-2, FREA, Hfh10, FREAC4, Hfhbf2, AI385632

UniProt

Q61345

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse FOXD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TGAGTGGGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISSRFP

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_032268

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JAG2 Protein Vector (Mouse) (pPM-C-His)
PV192849 500 ng

JAG2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
KP6 Killer Toxin (Biotin)
566688-01 50 µg

KP6 Killer Toxin (Biotin)

Sign In for Pricing
View Details
KP6 Killer Toxin (Biotin)
566688-02 100 µg

KP6 Killer Toxin (Biotin)

Sign In for Pricing
View Details
CD7 (CD7 Antigen, GP40, LEU 9, LEU-9, p41, T cell Antigen CD7 Precursor, T cell Leukemia Antigen, Tp40, TP41) (PE) discontinued
C2258-02C-PE 100 µL

CD7 (CD7 Antigen, GP40, LEU 9, LEU-9, p41, T cell Antigen CD7 Precursor, T cell Leukemia Antigen, Tp40, TP41) (PE) discontinued

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Endothelin 1 (EDN1)
MBS2113118-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Endothelin 1 (EDN1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Endothelin 1 (EDN1)
MBS2113118-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Endothelin 1 (EDN1)

Sign In for Pricing
View Details