Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXD1 Rabbit Polyclonal Antibody (HRP)

FOXD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BF-2, FREA, Hfh10, FREAC4, Hfhbf2, AI385632

UniProt

Q61345

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse FOXD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TGAGTGGGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISSRFP

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_032268

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Extract Broth (Powder) discontinued
E9010-01 1 Kg

Extract Broth (Powder) discontinued

Sign In for Pricing
View Details
Extract Broth (Powder) discontinued
E9010-02 2.5 Kg

Extract Broth (Powder) discontinued

Sign In for Pricing
View Details
Extract Broth (Powder) discontinued
E9010-03 10 Kg

Extract Broth (Powder) discontinued

Sign In for Pricing
View Details
APC Anti-Mouse CD206/MMR Antibody[C068C2]
FCE2849-01 25 µg

APC Anti-Mouse CD206/MMR Antibody[C068C2]

Sign In for Pricing
View Details
APC Anti-Mouse CD206/MMR Antibody[C068C2]
FCE2849-02 100 µg

APC Anti-Mouse CD206/MMR Antibody[C068C2]

Sign In for Pricing
View Details
NUDT11 (NM_018159) Human Over-expression Lysate
LS055190-20ug 20 µg

NUDT11 (NM_018159) Human Over-expression Lysate

Sign In for Pricing
View Details