Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Myt1 Rabbit Polyclonal Antibody (HRP)

Myt1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Nzf, NZF-, Nzf2, Nztf, Nzf2a, Nzf2b, Nztf2

UniProt

Q8CFC2

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of mouse Myt1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VSKRKSHPLRLALDEGYRMDSDGSEDAEVKDVSVSDESEGPLEEAEAEMS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

123kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_032691

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACAT-1 CRISPR/Cas9 KO Plasmid (h)
sc-402300 20 µg

ACAT-1 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
B33-302-494-YL Pre-sized Labels for Printers
307019 1500 Box (1500 Label (s) x 1 Roll)

B33-302-494-YL Pre-sized Labels for Printers

Sign In for Pricing
View Details
Hist2h3c1 sgRNA CRISPR Lentivector set (Mouse)
K4722601 3x 1.0 µg

Hist2h3c1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
C3orf24 sgRNA CRISPR Lentivector (Human) (Target 1)
K0229602 1.0 µg DNA

C3orf24 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
NAT8B Antibody
14-984 100 µL

NAT8B Antibody

Sign In for Pricing
View Details
Anti-Dynamin 1/DNM1 Antibody Picoband® (Dylight488 Conjugate)
A02536-2-Dylight488 100 µg

Anti-Dynamin 1/DNM1 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details