Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Opsin-3 (OPN3)

Product Specifications

Product Name Alternative

Encephalopsin Panopsin

Abbreviation

Recombinant Human OPN3 protein

Gene Name

OPN3

UniProt

Q9H1Y3

Expression Region

1-402aa

Organism

Homo sapiens (Human)

Target Sequence

MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNLLVLVLYYKFQRLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFSGSLFGIVSIATLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPLGVIAHCYGHILYSIRMLRCVEDLQTIQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVNGHGHLVTPTISIVSYLFAKSNTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Neuroscience

Relevance

May play a role in encephalic photoreception.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

47.7 kDa

References & Citations

"Encephalopsin: a novel mammalian extraretinal opsin discretely localized in the brain." Blackshaw S., Snyder S.H. J. Neurosci. 19:3681-3690 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccnd2 Mouse Gene Knockout Kit (CRISPR)
KN502810 1 Kit

Ccnd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Thiometon Sulfoxide
TRC-T344675-25MG 25 mg

Thiometon Sulfoxide

Sign In for Pricing
View Details
CD3 epsilon Recombinant Rabbit monoclonal Antibody
HA750115 100 µL

CD3 epsilon Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TIE2 (TEK) Mouse Monoclonal Antibody [Clone ID: B-B48]
AM31247PU-N 2 mL (200 Tests)

TIE2 (TEK) Mouse Monoclonal Antibody [Clone ID: B-B48]

Sign In for Pricing
View Details
CTAGE4 Human Gene Knockout Kit (CRISPR)
KN426160 1 Kit

CTAGE4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sinomenine Hydrochloride
TRC-S487500-500MG 500 mg

Sinomenine Hydrochloride

Sign In for Pricing
View Details