Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Opsin-3 (OPN3)

Product Specifications

Product Name Alternative

Encephalopsin Panopsin

Abbreviation

Recombinant Human OPN3 protein

Gene Name

OPN3

UniProt

Q9H1Y3

Expression Region

1-402aa

Organism

Homo sapiens (Human)

Target Sequence

MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNLLVLVLYYKFQRLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFSGSLFGIVSIATLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPLGVIAHCYGHILYSIRMLRCVEDLQTIQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVNGHGHLVTPTISIVSYLFAKSNTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Neuroscience

Relevance

May play a role in encephalic photoreception.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

47.7 kDa

References & Citations

"Encephalopsin: a novel mammalian extraretinal opsin discretely localized in the brain." Blackshaw S., Snyder S.H. J. Neurosci. 19:3681-3690 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEXA Mouse Monoclonal Antibody [Clone ID: 3F10]
AM06756PU-N 100 µg

HEXA Mouse Monoclonal Antibody [Clone ID: 3F10]

Sign In for Pricing
View Details
EDG2 (LPAR1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G6]
TA503737BM 100 µL

EDG2 (LPAR1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G6]

Sign In for Pricing
View Details
Recombinant Mucin-1 Antibody
RC-6820-01 50 μL

Recombinant Mucin-1 Antibody

Sign In for Pricing
View Details
Recombinant Mucin-1 Antibody
RC-6820-02 100 µL

Recombinant Mucin-1 Antibody

Sign In for Pricing
View Details
Recombinant Mucin-1 Antibody
RC-6820-03 1 mL

Recombinant Mucin-1 Antibody

Sign In for Pricing
View Details
Recombinant Mouse SIRPB1A/SIRP beta 1 Protein (His Tag)
PKSM040471 50 µg

Recombinant Mouse SIRPB1A/SIRP beta 1 Protein (His Tag)

Sign In for Pricing
View Details