Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB7A Rabbit Polyclonal Antibody (FITC)

ZBTB7A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L, Lrf, Pok, FBI-, FBI-1, Zbtb7, Pokemon, AI452336, 9030619K07Rik, 9130006G12Rik

UniProt

O88939

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse ZBTB7A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LEIPAVSHVCADLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEF

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_034861

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL 12 Human
OM296754-01 10 µg

IL 12 Human

Sign In for Pricing
View Details
IL 12 Human
OM296754-02 2 µg

IL 12 Human

Sign In for Pricing
View Details
IL 12 Human
OM296754-03 100 µg

IL 12 Human

Sign In for Pricing
View Details
Recombinant TSHB Monoclonal Antibody
AN301422L-01 50 µL

Recombinant TSHB Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant TSHB Monoclonal Antibody
AN301422L-02 100 µL

Recombinant TSHB Monoclonal Antibody

Sign In for Pricing
View Details
Proteasome subunit beta type 4 (PSMB4) (230-239) Goat Polyclonal Antibody
AP21517PU-N 100 µg

Proteasome subunit beta type 4 (PSMB4) (230-239) Goat Polyclonal Antibody

Sign In for Pricing
View Details