Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB7A Rabbit Polyclonal Antibody (FITC)

ZBTB7A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L, Lrf, Pok, FBI-, FBI-1, Zbtb7, Pokemon, AI452336, 9030619K07Rik, 9130006G12Rik

UniProt

O88939

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse ZBTB7A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LEIPAVSHVCADLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEF

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_034861

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS710592 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
GPX4 Recombinant Rabbit monoclonal Antibody [JU11-31]
ET1706-45-50UL 50 µL

GPX4 Recombinant Rabbit monoclonal Antibody [JU11-31]

Sign In for Pricing
View Details
CD47 / IAP (Integrin Associated Protein) (CD47/2937), CF405S conjugate, 0.1mg/mL
BNC042937-500 1x 500 µL

CD47 / IAP (Integrin Associated Protein) (CD47/2937), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Crotyl Alcohol (cis/trans Mixture)
TRC-C818820-5G 5 g

Crotyl Alcohol (cis/trans Mixture)

Sign In for Pricing
View Details
Recombinant Mouse Clusterin/ApoJ Protein (His Tag)
PKSM040656-01 50 µg

Recombinant Mouse Clusterin/ApoJ Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Clusterin/ApoJ Protein (His Tag)
PKSM040656-02 100 µg

Recombinant Mouse Clusterin/ApoJ Protein (His Tag)

Sign In for Pricing
View Details