Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nfe2l2 Rabbit Polyclonal Antibody (HRP)

Nfe2l2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O54968

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Nfe2l2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLIDILWRQDIDLGVSREVFDFSQRQKDYELEKQKKLEKERQEQLQKEQE

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_113977

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Antibody to Notch3
E10-30868 100 µL

Mouse Monoclonal Antibody to Notch3

Sign In for Pricing
View Details
PTF1A CRISPRa sgRNA lentivector (set of three targets)(Human)
38075121 3x 1.0µg DNA

PTF1A CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
NPHP4 sgRNA CRISPR Lentivector (Human) (Target 1)
K1445802 1.0 µg DNA

NPHP4 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Anti-Rhomboid-related protein 4 RHBDD1 Antibody
A09636 0.1 mg

Anti-Rhomboid-related protein 4 RHBDD1 Antibody

Sign In for Pricing
View Details
Human C-type lectin domain family 12, member B (CLEC12B) ELISA kit
YLA4139HU-01 48 Tests

Human C-type lectin domain family 12, member B (CLEC12B) ELISA kit

Sign In for Pricing
View Details
Human C-type lectin domain family 12, member B (CLEC12B) ELISA kit
YLA4139HU-02 96 Tests

Human C-type lectin domain family 12, member B (CLEC12B) ELISA kit

Sign In for Pricing
View Details