Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tgfb1 Rabbit Polyclonal Antibody (FITC)

Tgfb1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Tgfb, Tgfb-1, TGFbeta, TGF-beta, TGFbeta1, TGF-beta1

UniProt

P01137

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Tgfb1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_035707

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protonitazene Dihydrochloride
TRC-P756325-5MG 5 mg

Protonitazene Dihydrochloride

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), 0.2mg/mL
BNUB1422-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), 0.2mg/mL

Sign In for Pricing
View Details
alpha Sarcoglycan (SGCA) (NM_000023) Human Over-expression Lysate
LY400004 100 µg

alpha Sarcoglycan (SGCA) (NM_000023) Human Over-expression Lysate

Sign In for Pricing
View Details
GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF640R conjugate, 0.1mg/mL
BNC401960-500 1x 500 µL

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS500144 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (PDCD1/2720), CF488A conjugate, 0.1mg/mL
BNC882720-500 1x 500 µL

PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (PDCD1/2720), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details