Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zscan12 Rabbit Polyclonal Antibody (FITC)

Zscan12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Zfp9, Zfp96, FPM315, zfp-96, mKIAA0426, 2510038J07Rik

UniProt

Q9Z1D7

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NSSLATHQETHHKEKPFTQSGPIQQQRNHTKEKPYKCSVCGKAFIQKISL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_057893

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIF-1alpha Rabbit mAb
A22041 100 µL

HIF-1alpha Rabbit mAb

Sign In for Pricing
View Details
PGC Mouse Monoclonal Antibody (PerCP-Cy5.5)
orb2365684 100 µL

PGC Mouse Monoclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Mouse Thrombospondin 3 (THBS3) ELISA Kit
YP-W200305-01 48 Tests

Mouse Thrombospondin 3 (THBS3) ELISA Kit

Sign In for Pricing
View Details
Mouse Thrombospondin 3 (THBS3) ELISA Kit
YP-W200305-02 96 Tests

Mouse Thrombospondin 3 (THBS3) ELISA Kit

Sign In for Pricing
View Details
Human ACOX3 Knockout HEK293T cell line
GTR15411694 1 Vial

Human ACOX3 Knockout HEK293T cell line

Sign In for Pricing
View Details
RAET1E (Retinoic Acid Early Transcript 1E, NKG2D Ligand 4, N2DL4, N2DL-4, NKG2DL4, Lymphocyte Effector Toxicity Activation Ligand, LETAL, RAE-1-like Transcript 4, RL-4, ULBP4, UNQ1867/PRO4303) (MaxLight 550)
MBS6213512-01 0.1 mL

RAET1E (Retinoic Acid Early Transcript 1E, NKG2D Ligand 4, N2DL4, N2DL-4, NKG2DL4, Lymphocyte Effector Toxicity Activation Ligand, LETAL, RAE-1-like Transcript 4, RL-4, ULBP4, UNQ1867/PRO4303) (MaxLight 550)

Sign In for Pricing
View Details