Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDLIM1 Rabbit Polyclonal Antibody (Biotin)

PDLIM1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CLP, mCli, CLP36, Clim1, mClim1

UniProt

O70400

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse PDLIM1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TSASGEEANSRPVVQPHPSGSLIIDKDSEVYKMLQEKQELNEPPKQSTSF

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_058557

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Way 123783
orb1694878 25 mg

Way 123783

Sign In for Pricing
View Details
Rat Heat shock protein HSP 90-alpha (Hsp90aa1/Hsp86/Hspca) ELISA kit
CSB-E08309r-01 48 Tests

Rat Heat shock protein HSP 90-alpha (Hsp90aa1/Hsp86/Hspca) ELISA kit

Sign In for Pricing
View Details
Rat Heat shock protein HSP 90-alpha (Hsp90aa1/Hsp86/Hspca) ELISA kit
CSB-E08309r-02 96 Tests

Rat Heat shock protein HSP 90-alpha (Hsp90aa1/Hsp86/Hspca) ELISA kit

Sign In for Pricing
View Details
Rat Heat shock protein HSP 90-alpha (Hsp90aa1/Hsp86/Hspca) ELISA kit
CSB-E08309r-03 5x 96 Tests

Rat Heat shock protein HSP 90-alpha (Hsp90aa1/Hsp86/Hspca) ELISA kit

Sign In for Pricing
View Details
Rat Heat shock protein HSP 90-alpha (Hsp90aa1/Hsp86/Hspca) ELISA kit
CSB-E08309r-04 10x 96 Tests

Rat Heat shock protein HSP 90-alpha (Hsp90aa1/Hsp86/Hspca) ELISA kit

Sign In for Pricing
View Details
Lentiviral human TRIM26 sgRNA gene knockout kit - Lentiviral human TRIM26 sgRNA gene knockout kit (plasmid)
GTR15359867 1 Vial

Lentiviral human TRIM26 sgRNA gene knockout kit - Lentiviral human TRIM26 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details