Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF1B Rabbit Polyclonal Antibody (HRP)

TAF1B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P6, p63, mTAFI, TAFI68, Tafi86, 4930408G01Rik, A230108M10Rik

UniProt

P97358

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse TAF1B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YQFILNIFSFLLRIKTSALHEEVSLLEKKLFEKKYNESKKSSGSKKGRRH

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_065639

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/2403), CF647 conjugate, 0.1mg/mL
BNC472403-500 1x 500 µL

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/2403), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mrpl11 (NM_025553) Mouse Tagged ORF Clone
MG201839 10 µg

Mrpl11 (NM_025553) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SNX7 Rabbit Polyclonal Antibody
TA381866 100 µL

SNX7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PTF1A Mouse Monoclonal Antibody [Clone ID: OTI5E5]
CF810945 100 µg

PTF1A Mouse Monoclonal Antibody [Clone ID: OTI5E5]

Sign In for Pricing
View Details
Cdk5 Mouse Gene Knockout Kit (CRISPR)
KN303042RB 1 Kit

Cdk5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cysteine Dioxygenase Type 1 (CDO1) (NM_001801) Human Recombinant Protein
TP306067M 100 µg

Cysteine Dioxygenase Type 1 (CDO1) (NM_001801) Human Recombinant Protein

Sign In for Pricing
View Details