Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEF2C Rabbit Polyclonal Antibody (Biotin)

MEF2C Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Mef2, AV011172, 5430401D19Rik, 9930028G15Rik

UniProt

Q8CFN5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse MEF2C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SRTNSDIVEALNKKENKGSESPDPDSSYALTPRTEEKYKKINEEFDNMIK

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079558

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BPIFA1 Protein Vector (Human) (pPB-His-MBP)
PV327342 500 ng

BPIFA1 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Canine Actin, cytoplasmic 1 (ACTB) ELISA Kit
MBS286807-01 48 Tests

Canine Actin, cytoplasmic 1 (ACTB) ELISA Kit

Sign In for Pricing
View Details
Canine Actin, cytoplasmic 1 (ACTB) ELISA Kit
MBS286807-02 96 Tests

Canine Actin, cytoplasmic 1 (ACTB) ELISA Kit

Sign In for Pricing
View Details
Canine Actin, cytoplasmic 1 (ACTB) ELISA Kit
MBS286807-03 5x 96 Tests

Canine Actin, cytoplasmic 1 (ACTB) ELISA Kit

Sign In for Pricing
View Details
Canine Actin, cytoplasmic 1 (ACTB) ELISA Kit
MBS286807-04 10x 96 Tests

Canine Actin, cytoplasmic 1 (ACTB) ELISA Kit

Sign In for Pricing
View Details
GTPBP4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
22821111 3x 1.0 µg

GTPBP4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details