Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ddx54 Rabbit Polyclonal Antibody (HRP)

Ddx54 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AP, DP9, DP97, AI414901, 2410015A15Rik

UniProt

Q8K4L0

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ISSSYKRDLYQKWKQKQKIDDRDSEEEGPSNQRGPGPRRGGKRGRSQGTS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_082317

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Vimentin Purified
11-254-C025 0.025 mg

Anti-Vimentin Purified

Sign In for Pricing
View Details
Mouse SerpinD1 HEK293 Overexpression Lysate
MBS8116392-01 0.3 mg

Mouse SerpinD1 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Mouse SerpinD1 HEK293 Overexpression Lysate
MBS8116392-02 5x 0.3 mg

Mouse SerpinD1 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
PACRG (NM_001080379) Human Tagged ORF Clone Lentiviral Particle
RC208166L4V 200 µL

PACRG (NM_001080379) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Goat Dual Specificity Protein Phosphatase 15 (DUSP15) ELISA Kit
MBS9938771 Inquire

Goat Dual Specificity Protein Phosphatase 15 (DUSP15) ELISA Kit

Sign In for Pricing
View Details
SMAP2 Mouse Monoclonal Antibody [Clone 9B6]
E45M20100V-2 50 µL

SMAP2 Mouse Monoclonal Antibody [Clone 9B6]

Sign In for Pricing
View Details