Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARN Rabbit Polyclonal Antibody (FITC)

PARN Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

D, DAN, 1200003I18Rik

UniProt

Q8VDG3

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IEEADFFAIDGEFSGISNGPSVTALTSGFDTPEERYQKLKKHSMDFLLFQ

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_083037

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Orexin receptor type 2 (HCRTR2) ELISA Kit
MBS7253035-01 48 Well

Mouse Orexin receptor type 2 (HCRTR2) ELISA Kit

Sign In for Pricing
View Details
Mouse Orexin receptor type 2 (HCRTR2) ELISA Kit
MBS7253035-02 96 Well

Mouse Orexin receptor type 2 (HCRTR2) ELISA Kit

Sign In for Pricing
View Details
Mouse Orexin receptor type 2 (HCRTR2) ELISA Kit
MBS7253035-03 5x 96 Well

Mouse Orexin receptor type 2 (HCRTR2) ELISA Kit

Sign In for Pricing
View Details
Mouse Orexin receptor type 2 (HCRTR2) ELISA Kit
MBS7253035-04 10x 96 Well

Mouse Orexin receptor type 2 (HCRTR2) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Glod4 shRNA (UAS) - Lentiviral mouse Glod4 shRNA (UAS) (100)
GTR15211878 1 Vial

Lentiviral mouse Glod4 shRNA (UAS) - Lentiviral mouse Glod4 shRNA (UAS) (100)

Sign In for Pricing
View Details
Rat Ankyrin repeat domain-containing protein 29 (ANKRD29) ELISA Kit
MBS7233685-01 48 Well

Rat Ankyrin repeat domain-containing protein 29 (ANKRD29) ELISA Kit

Sign In for Pricing
View Details