Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMRTA1 Rabbit Polyclonal Antibody (HRP)

DMRTA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Dmrt, Dmrt4

UniProt

Q8CFG4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse DMRTA1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LRRQQAQEESEARGLHRLLYQGSSGSGAQASGGSGRTESPQVLNNPMAVA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_783578

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIP13 Antibody
GWB-MM766A 50 µg

TRIP13 Antibody

Sign In for Pricing
View Details
CYP21A2 Antibody - C-terminal region : Biotin (ARP60144_P050-Biotin)
ARP60144_P050-Biotin 100 µL

CYP21A2 Antibody - C-terminal region : Biotin (ARP60144_P050-Biotin)

Sign In for Pricing
View Details
SLMO2, ID (SLMO2, C20orf45, Protein slowmo homolog 2) (AP)
MBS6348682-01 0.2 mL

SLMO2, ID (SLMO2, C20orf45, Protein slowmo homolog 2) (AP)

Sign In for Pricing
View Details
SLMO2, ID (SLMO2, C20orf45, Protein slowmo homolog 2) (AP)
MBS6348682-02 5x 0.2 mL

SLMO2, ID (SLMO2, C20orf45, Protein slowmo homolog 2) (AP)

Sign In for Pricing
View Details
PPP1R26P4 ORF Vector (Human) (pORF)
ORF028200 1.0 µg DNA

PPP1R26P4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Cynomolgus, Rhesus Monkey Recombinant Dkk-1 Protein
NHFF-0524-HX442 Each

Cynomolgus, Rhesus Monkey Recombinant Dkk-1 Protein

Sign In for Pricing
View Details