Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tppp Rabbit Polyclonal Antibody (HRP)

Tppp Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI849835, TPPP/p25, 2900041A09Rik

UniProt

Q7TQD2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse 2900041A09RIK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KAVSSPTVSRLTDTSKFTGSHKERFDQSGKGKGKAGRVDLVDESGYVPGY

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_878259

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD226 (CD226 Antigen, Adhesion Glycoprotein, DNAX Accessory Molecule 1, DNAM1, DNAM-1, Platelet and T cell Activation Antigen 1, PTA1, TLiSA1) (Azide Free)
C2548-97G2 1 mg

CD226 (CD226 Antigen, Adhesion Glycoprotein, DNAX Accessory Molecule 1, DNAM1, DNAM-1, Platelet and T cell Activation Antigen 1, PTA1, TLiSA1) (Azide Free)

Sign In for Pricing
View Details
C2 (NM_000063) Human Tagged ORF Clone Lentiviral Particle
RC208097L1V 200 µL

C2 (NM_000063) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Bex1/2 (D-6) PE
sc-376342 PE 200 µg/mL

Bex1/2 (D-6) PE

Sign In for Pricing
View Details
B4GALT2 Knockout Cell Lysate
ABC-KC0173 100 µg

B4GALT2 Knockout Cell Lysate

Sign In for Pricing
View Details
1-39-Corticotropin (human) (TFA)
orb1679781-01 1 mg

1-39-Corticotropin (human) (TFA)

Sign In for Pricing
View Details
1-39-Corticotropin (human) (TFA)
orb1679781-02 5 mg

1-39-Corticotropin (human) (TFA)

Sign In for Pricing
View Details