Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxe1 Rabbit Polyclonal Antibody (HRP)

Foxe1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Titf, TTF-2, Titf2

UniProt

Q8R2I0

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FYGRTSPGQFGAALGPCYNPGGQLGAGGGGAYHSRHATAYPGAVDRFVSA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_899121

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTGER2 Rabbit Polyclonal Antibody
E53P08403 100 µL

PTGER2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rn Antibody
orb807244 2 mg

Rn Antibody

Sign In for Pricing
View Details
MAP2 (NM_002374) Human Untagged Clone
SC309886 10 µg

MAP2 (NM_002374) Human Untagged Clone

Sign In for Pricing
View Details
Activin Receptor Type IIB Polyclonal Antibody, APC-Cy7 Conjugated
bs-12417R-APC-Cy7 100 µL

Activin Receptor Type IIB Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Rabbit Anti-Human IgG F (ab') 2 Antibody (AF660)
abx142633-01 100 µL

Rabbit Anti-Human IgG F (ab') 2 Antibody (AF660)

Sign In for Pricing
View Details
Rabbit Anti-Human IgG F (ab') 2 Antibody (AF660)
abx142633-02 500 µL

Rabbit Anti-Human IgG F (ab') 2 Antibody (AF660)

Sign In for Pricing
View Details